PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G14050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 164aa    MW: 18022.7 Da    PI: 10.1052
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G14050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.18.5e-132367147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW+ eE++++++a  ++G + Wk+I   +  ++t+ q++s+ qk+
     OB05G14050.1 23 RERWSGEEHDRFLHALMLFGRD-WKRIEGFVA-TKTAIQIRSHAQKH 67
                     78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-161773IPR009057Homeodomain-like
PROSITE profilePS5129414.8421872IPR017930Myb domain
SMARTSM007178.3E-92270IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-152270IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.9E-72367IPR009057Homeodomain-like
PfamPF002498.7E-102367IPR001005SANT/Myb domain
CDDcd001671.20E-72568No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAAMAGPGGG GEGGGPYTIT RPRERWSGEE HDRFLHALML FGRDWKRIEG FVATKTAIQI  60
RSHAQKHFLK ARKFGPPGAP PPPLHPRRAT PPACYAYSPE DSFRPLIQSN DLGFAQVYKF  120
VGDVFGSGEP RPVEAHLRRL HGMDPAISET ILLVLRNLAA NLCA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241442e-46AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence.
GenBankAP0149612e-46AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126132e-46CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655018.23e-90PREDICTED: protein REVEILLE 5-like
SwissprotQ8RWU35e-28RVE8_ARATH; Protein REVEILLE 8
TrEMBLJ3M4811e-118J3M481_ORYBR; Uncharacterized protein
STRINGOB05G14050.11e-118(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-24MYB_related family protein